Protein Info for MPMX19_05514 in Azospirillum sp. SherDot2

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01113: DapB_N
  • amino acids 1 to 124 (124 residues), 116.5 bits, E=8.2e-38
• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 1 to 264 (264 residues), 265.1 bits, E=3.9e-83
• PF05173: DapB_C
  • amino acids 127 to 263 (137 residues), 148.5 bits, E=9.6e-48

Best Hits

Swiss-Prot: 60% identical to DAPB1_RHILO: 4-hydroxy-tetrahydrodipicolinate reductase 1 (dapB1) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 92% identity to azl:AZL_d00780)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Protein Sequence (265 amino acids)

>MPMX19_05514 4-hydroxy-tetrahydrodipicolinate reductase (Azospirillum sp. SherDot2)
MKIGVVGCAGRMGQMLVREIAATAGCTLAGGTERLGGPALGKDLGILAGIDPLGVTAIDD
PVALFAEADAVIDFTSPDSTERHAALAAQSETVLVVGTTGLNPSQQAAIAAAATHTAIVQ
SPNMSLGVNLLLALVEQVAHALDDDYDIDILEMHHRRKVDAPSGTALGLGRAAAAGRGVA
LEDVWQKVRDGHTGARPRGEIGFATLRGGDVIGDHTVFFASEGERVELTHKASGRGIYAK
GAVRAALWAQDKTPGLYSMRDVLGV