Protein Info for MPMX19_05427 in Azospirillum sp. SherDot2

Annotation: L-glyceraldehyde 3-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00248: Aldo_ket_red
  • amino acids 30 to 332 (303 residues), 239.6 bits, E=2e-75

Best Hits

Swiss-Prot: 62% identical to GPR_ECO57: L-glyceraldehyde 3-phosphate reductase (gpr) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 90% identity to azl:AZL_d04730)

MetaCyc: 62% identical to L-glyceraldehyde 3-phosphate reductase (Escherichia coli K-12 substr. MG1655)
Aldehyde reductase. [EC: 1.1.1.21]; 1.1.1.- [EC: 1.1.1.21]

Predicted SEED Role

"Putative ion-channel protein"

MetaCyc Pathways

• methylglyoxal degradation III (1/2 steps found)
• D-arabinose degradation V (1/3 steps found)
• D-galactose degradation IV (1/3 steps found)
• superpathway of methylglyoxal degradation (4/8 steps found)
• detoxification of reactive carbonyls in chloroplasts (1/10 steps found)
• superpathway of pentose and pentitol degradation (14/42 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Galactose metabolism
• Glycerolipid metabolism
• Pentose and glucuronate interconversions
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.21

Protein Sequence (351 amino acids)

>MPMX19_05427 L-glyceraldehyde 3-phosphate reductase (Azospirillum sp. SherDot2)
MQPPYLAADKRYGSMSYRRTGRSGLDLPAISLGLWQNFGGTDVFATGRAVLRRAFDRGVT
HFDLANNYGPPPGSAEENFGRILATDFRPYRDEMVISTKAGYEMWPGPYGNWGSRKYLVS
SLDQSLTRMGLDYVDIFYSHRVDPRTPLEETMGALDHIVRQGKALYVGISSYSPEMTRRA
VGILKQLGTPCLIHQPSYSMLNRWVEGNGGGGLLDTLEDLGMGCIAFSPMAQGMLTNKYL
GGQPADARAAKGGSLRANFLSPENLERIRALDAIAKRRGQTLAQMAIAWVLRDPRVTSAL
IGARNVEQLDNSLDALNSLSFSPEELAEIDTHAVADAGINLWSASSAAEAG