Protein Info for MPMX19_05387 in Azospirillum sp. SherDot2

Annotation: 1,4-dihydroxy-2-naphthoyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF13279: 4HBT_2" amino acids 32 to 151 (120 residues), 44.1 bits, see alignment E=2.8e-15 PF03061: 4HBT" amino acids 65 to 123 (59 residues), 27.7 bits, see alignment E=2.9e-10

Best Hits

KEGG orthology group: None (inferred from 94% identity to azl:AZL_d05120)

MetaCyc: 39% identical to benzoyl-coA thioesterase monomer (Aromatoleum evansii)
RXN-2005

Predicted SEED Role

"Putative 4-hydroxybenzoyl CoA thioesterase (EC 3.1.2.23)" (EC 3.1.2.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>MPMX19_05387 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Azospirillum sp. SherDot2)
MPEYSERTRHAEDHASHRPLPAGCFRVQRPIRFSHCDPAGIVYFPVYFDMFNGAVEDWFT
QGLDIDYATMILQRRLGLPIVHAECDFVIPSRMGDTLTLGVLLERLGRSSLQLRINGEHE
GQVRLSGSLTVVTTSLDDFAAVPIPDDIRAAMKRYQAGCEG