Protein Info for MPMX19_05326 in Azospirillum sp. SherDot2

Annotation: S-(hydroxymethyl)glutathione dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 72% identical to FRMA_SYNY3: S-(hydroxymethyl)glutathione dehydrogenase (frmA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00121, S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC: 1.1.1.1 1.1.1.284] (inferred from 100% identity to azl:AZL_c02590)

MetaCyc: 67% identical to alcohol dehydrogenase class-3 monomer (Homo sapiens)
S-(hydroxymethyl)glutathione dehydrogenase. [EC: 1.1.1.284]; 1.1.1.284 [EC: 1.1.1.284]

Predicted SEED Role

"S-(hydroxymethyl)glutathione dehydrogenase (EC 1.1.1.284)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 1.1.1.284)

MetaCyc Pathways

mixed acid fermentation (14/16 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
superpathway of anaerobic sucrose degradation (16/19 steps found)
heterolactic fermentation (15/18 steps found)
ethanolamine utilization (5/5 steps found)
superpathway of N-acetylneuraminate degradation (17/22 steps found)
3-methylbutanol biosynthesis (engineered) (6/7 steps found)
ethanol degradation II (3/3 steps found)
formaldehyde oxidation II (glutathione-dependent) (3/3 steps found)
pyruvate fermentation to ethanol I (3/3 steps found)
pyruvate fermentation to ethanol III (3/3 steps found)
ethanol degradation I (2/2 steps found)
superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
acetylene degradation (anaerobic) (4/5 steps found)
pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
superpathway of C1 compounds oxidation to CO₂ (9/12 steps found)
acetaldehyde biosynthesis I (1/1 steps found)
L-phenylalanine degradation III (3/4 steps found)
phytol degradation (3/4 steps found)
L-isoleucine degradation II (2/3 steps found)
L-leucine degradation III (2/3 steps found)
L-valine degradation II (2/3 steps found)
pyruvate fermentation to ethanol II (1/2 steps found)
(S)-propane-1,2-diol degradation (3/5 steps found)
protein S-nitrosylation and denitrosylation (3/5 steps found)
L-tyrosine degradation III (2/4 steps found)
L-methionine degradation III (1/3 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (8/13 steps found)
salidroside biosynthesis (1/4 steps found)
serotonin degradation (3/7 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
phenylethanol biosynthesis (1/5 steps found)
butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
noradrenaline and adrenaline degradation (4/13 steps found)
L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.284

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>MPMX19_05326 S-(hydroxymethyl)glutathione dehydrogenase (Azospirillum sp. SherDot2)
MVLSRAAVAWEANRPLEIEEVEVAAPKAGEVMVRIVATGVCHTDAYTLSGKDSEGVFPCI
LGHEGGGVVVEVGPGVTSVAVGDHVIPLYTPECGKCKFCLSGKTNLCQAIRATQGKGLMP
DGTSRFSLKGKEIAHYMGTSTFSEYTVLPEIALAKINKAAPLEKVCLLGCGVTTGMGAVM
NTAKVEPGSTVAIFGLGGIGLSAIIGATMAKASRIIGIDVNPSKFEIAKQLGATDVVNPM
DFDRPIQEVLVEMTDGGVDYSFECIGNVKVMRAALECCHKGWGESVIIGVAGAGEEIATR
PFQLVTGRVWRGSAFGGVKGRSELPEYVERYLRGEFELDTFITHTMGLEDINHAFDLMHE
GKSIRSVILYNQ