Protein Info for MPMX19_05245 in Azospirillum sp. SherDot2

Annotation: Trifunctional nucleotide phosphoesterase protein YfkN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00149: Metallophos
  • amino acids 31 to 232 (202 residues), 35.8 bits, E=1.1e-12
• PF02872: 5_nucleotid_C
  • amino acids 309 to 464 (156 residues), 156.6 bits, E=5.8e-50

Best Hits

KEGG orthology group: None (inferred from 93% identity to azl:AZL_c02340)

Predicted SEED Role

"5'-nucleotidase (EC 3.1.3.5)" in subsystem Purine conversions (EC 3.1.3.5)

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• ureide biosynthesis (6/7 steps found)
• guanosine nucleotides degradation II (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• NAD salvage (plants) (6/11 steps found)
• superpathway of purines degradation in plants (9/18 steps found)
• tunicamycin biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Protein Sequence (504 amino acids)

>MPMX19_05245 Trifunctional nucleotide phosphoesterase protein YfkN (Azospirillum sp. SherDot2)
MLSRTRLVAAPLFAIMLGAALPAWAQSGTLTFLHVNDVYEIAPVKGQGGFGPLMTLLKRE
RAAAPDAITTVGGDFLSPSLLSGTTRGEQMIALFNAIGVDAVTFGNHEFDFGPDLLKQRM
AESKFPWIGTNVRAADGSAFASTVPSWTRTIDGITVGFLGLITPDTARLSSAGPSLDFPP
VLETAAATVKELRAKGASVVVALTHLTIEEDRELASKVKGIDLILGGHDHDPISFYEGST
LILKAGHDAQYLGVVKLAVETKDADKGPATTTVPTEWRFVTTAGVAPDPEVETVVEGYTK
RLDSDLAAVIGTTTTELDSRKDVVRSREASMGNLIADALRDTLKADVAITNGGGIRADAL
HPAGSRLTRKDIFAELPFGNVGVLVDMSGQDLISTLEHGVSKVEEKAGRFPQVSGLTMTY
DPKAPAGRRVTSILVGGKPVDPQATYRVATNDYMLKGGDGYAAFPRSKVIVDASGAVLLA
TIVMNYVEAKKTVAPTVDGRIVAK