Protein Info for MPMX19_05241 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 60 to 89 (30 residues), see Phobius details amino acids 94 to 94 (1 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details PF02588: YitT_membrane" amino acids 35 to 203 (169 residues), 92.8 bits, see alignment E=9.9e-31

Best Hits

KEGG orthology group: None (inferred from 88% identity to azl:AZL_c02380)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>MPMX19_05241 hypothetical protein (Azospirillum sp. SherDot2)
MTNNSASTISSSPASVTYERPKAAHSVFDNLQGQLFGIVMTSFGIAILHAAGLVTGQAAG
LAFVISYATGIDFGTLFFLVNLPFYFLALARIGVGFTIKSLIAVTGIAVLSGLLPTMMSF
SAINPYVAAVLAGFCVGIGVIALFRHGASGGGVGILAFYLQEKTGFRAGWLQSLFDLAVF
SAAAFVLDWPALLASILGAAVLNAFVAFNHRADWYVAR