Protein Info for MPMX19_05201 in Azospirillum sp. SherDot2

Annotation: Hydroxycarboxylate dehydrogenase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 42% identical to HCXB_ECO57: Hydroxycarboxylate dehydrogenase B (hcxB) from Escherichia coli O157:H7

KEGG orthology group: K13574, uncharacterized oxidoreductase [EC: 1.1.1.-] (inferred from 96% identity to azl:AZL_a00760)

MetaCyc: 42% identical to hydroxycarboxylate dehydrogenase B (Escherichia coli K-12 substr. MG1655)
Hydroxyphenylpyruvate reductase. [EC: 1.1.1.237]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
mixed acid fermentation (14/16 steps found)
superpathway of glyoxylate bypass and TCA (11/12 steps found)
TCA cycle I (prokaryotic) (9/10 steps found)
TCA cycle III (animals) (9/10 steps found)
TCA cycle VIII (Chlamydia) (6/6 steps found)
glyoxylate cycle (6/6 steps found)
TCA cycle II (plants and fungi) (8/9 steps found)
TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
gluconeogenesis III (10/12 steps found)
anaerobic energy metabolism (invertebrates, cytosol) (6/7 steps found)
superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
gluconeogenesis I (10/13 steps found)
malate/L-aspartate shuttle pathway (2/2 steps found)
(S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)
reductive TCA cycle I (7/11 steps found)
incomplete reductive TCA cycle (4/7 steps found)
pyruvate fermentation to propanoate I (4/7 steps found)
reductive TCA cycle II (7/12 steps found)
methylaspartate cycle (12/19 steps found)
rosmarinic acid biosynthesis II (1/4 steps found)
C4 photosynthetic carbon assimilation cycle, NAD-ME type (6/11 steps found)
formaldehyde assimilation I (serine pathway) (7/13 steps found)
L-glutamate degradation VIII (to propanoate) (4/11 steps found)
rosmarinic acid biosynthesis I (2/10 steps found)
superpathway of rosmarinic acid biosynthesis (3/14 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.37

Use Curated BLAST to search for 1.1.1.- or 1.1.1.237 or 1.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>MPMX19_05201 Hydroxycarboxylate dehydrogenase B (Azospirillum sp. SherDot2)
MSEVRYRPDRLVATLDAILRRSGSSAEEAAIVAANLVEADARGHASHGVCQIAVYARSLE
LGHLQPNRHARIVRDEAPFLVVDGDVGYGQVIAREATDLAIERARAGGACILALRNAHHI
GRVGSYGEQCIAAGLIGLYFVNVVSRPLAAPHGGGRPRLGTNPVCIAVPGTPGFAPFLLD
FATSAIAANKCRIAASLGKEVEDGLLLDPDGRPTRDPAVMFTEPTGAILPFGGHKGYGLA
LACEILAGALAGGLPALPENLRPGRVVNNALAFVIDPNRVAGPEWQTLTDAVLDHVADTP
VAPGSDGVSIPGEPEALHRMAAMDRGIALDPDTVAALHRIGGGLGLDVQGLLEG