Protein Info for MPMX19_05193 in Azospirillum sp. SherDot2

Annotation: Taurine-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF04069: OpuAC" amino acids 31 to 299 (269 residues), 49.4 bits, see alignment E=9.6e-17 TIGR01729: taurine ABC transporter, periplasmic binding protein" amino acids 32 to 335 (304 residues), 323.8 bits, see alignment E=5.7e-101 PF13379: NMT1_2" amino acids 34 to 237 (204 residues), 58.8 bits, see alignment E=1.5e-19 PF09084: NMT1" amino acids 39 to 238 (200 residues), 58.9 bits, see alignment E=1.4e-19 PF12974: Phosphonate-bd" amino acids 52 to 202 (151 residues), 53.7 bits, see alignment E=4.1e-18

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 92% identity to azl:AZL_b02650)

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>MPMX19_05193 Taurine-binding periplasmic protein (Azospirillum sp. SherDot2)
MKPTLPTLLSAALAAVVPFAASTIAEAASGKVVVGYQTDALPSSVAIANGDFAKATGTEI
DFRKFNSGAEIFAAIASGDVQVGYVGSSPFAAAVSRGLDVKAFHLATISGTDEALVVRNG
SGIEKPSDLKGKKLAAAPVSTDHYQLLAVLKQEKLTERDAQVFAIPQPDIVAAWNRGDLD
GAFVWDPALTELKKTGRVLLTSREVADRGAPTFSAWVATAAFAKDNPAFLKGFAGTIERY
STSFRNDKAAWGPDSENAKTLAKLLGGTPSDQASALTNLSLVPAEVQASTAWLAGGEGSG
AAKILKDTAEFLKEQKKITTVLPSYGGFVTADYVKDVR