Protein Info for MPMX19_05187 in Azospirillum sp. SherDot2

Annotation: 3-mercaptopropionate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF05995: CDO_I" amino acids 59 to 174 (116 residues), 26 bits, see alignment E=3e-10

Best Hits

Swiss-Prot: 61% identical to 3MDO_PSEAE: 3-mercaptopropionate dioxygenase (PA2602) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 86% identity to azl:AZL_b02610)

MetaCyc: 55% identical to 3-mercaptopropionate dioxygenase (Variovorax paradoxus)
RXN-15364 [EC: 1.13.11.91]

Predicted SEED Role

"Cysteine dioxygenase (EC 1.13.11.20)" (EC 1.13.11.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.20

Use Curated BLAST to search for 1.13.11.20 or 1.13.11.91

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>MPMX19_05187 3-mercaptopropionate dioxygenase (Azospirillum sp. SherDot2)
MPDSLPPDTATPNLQRLRGFIADFTRLMERHGDDEPAALDAGRALLAGLIAVDDWLPDAY
AQPDPVHYRQYLLHCDPYERFSVVSFVWGPGQRTPIHDHTVWGLVGILRGAERSQRYDLQ
PQGGPPVASPPEILKAGSVEAVSPRIGDVHAISNALADRPSISIHVYGGNIGAIRRSVFD
PLTGQRKPFISGYANSALPNLWDRSQPVPHAA