Protein Info for MPMX19_05162 in Azospirillum sp. SherDot2

Annotation: Ferrous-iron efflux pump FieF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 22 to 24 (3 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 6 to 277 (272 residues), 204.4 bits, see alignment E=1.1e-64 PF01545: Cation_efflux" amino acids 12 to 202 (191 residues), 158.6 bits, see alignment E=1.8e-50 PF16916: ZT_dimer" amino acids 210 to 281 (72 residues), 35.9 bits, see alignment E=6.4e-13 amino acids 303 to 361 (59 residues), 38.7 bits, see alignment E=8.8e-14 amino acids 395 to 453 (59 residues), 37.5 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: None (inferred from 91% identity to azl:AZL_c01390)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>MPMX19_05162 Ferrous-iron efflux pump FieF (Azospirillum sp. SherDot2)
MSSEKETVALGSILASGAMTVGKFGVGLSTGSLGLLSEGLHSLLDLGATVMTWFAVRISD
KPADAGHPYGHGKIESVAALAETGLLFLTSAWIAYEAVRRLIDGGVEVEATWWSVAVVVV
CIAVDAYRARELSRVAKETRSQALEADALHFSSDILSSAVVLVGLGLVWLGYPKGDALAA
IGVSVFVCHAGYQLGRRTIDTLIDAAPAGTAERVEAVVRDMPGIAGVQRVRVRPAGSVLF
VDLDLLVGRTLTLDAAAALRERAIGAVQAEMPEAEVTVATHPLALDDETVMDRVAVRAAG
LGLAVHHVTVQRVNGRLAVGFDLEVDGSLPVEAAHALSSRLEDSIREELGTDIEVESHIE
PLQENGLTGVDAEPDLLRAIGAHLSASLPMAGPLRDIHNLRVRRSAAGLVVTFHSHVAPG
TTVVAVHDAIDALERDLRSRWPDIVRVIGHSEPDHDERPVPGKPQAEKAAGAA