Protein Info for MPMX19_05147 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR03261: putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein" amino acids 18 to 346 (329 residues), 518.2 bits, see alignment E=4.3e-160 PF13531: SBP_bac_11" amino acids 35 to 288 (254 residues), 52.6 bits, see alignment E=8.2e-18 PF01547: SBP_bac_1" amino acids 44 to 287 (244 residues), 57.1 bits, see alignment E=4.6e-19 PF13343: SBP_bac_6" amino acids 82 to 308 (227 residues), 86.1 bits, see alignment E=4e-28

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 92% identity to azl:AZL_a10530)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>MPMX19_05147 hypothetical protein (Azospirillum sp. SherDot2)
MIRRTTLPGTCALALLTTVAFATGAATAAGAATRLTVYTALENEQLTPYKKAFEADNPGI
EIEWVRDSTGVVTAKLLAEKDNPKADVVWGLAASSLMILDAQGMLMPYQPKGAEDLKSSF
RDAKTPPAWVGMDAWMAAICFNTVEAEKKKLPKPTSWADLLKPEYKGQIVMPNPASSGTG
FLAVSGWLQTMGADRGWSYMDGLNDNVALYTHSGSKPCKMAAAGEYPIGISIEYTGAQQK
TKGAPIDVILASEGVGWEMEATAIVKGTQKAEAAKALADWAASRKANEQYVNFYQVTAHP
GVTKETPNYPKNAEAAMNKANDFVWAAANRDRILADWEKRYGAKSEPKS