Protein Info for MPMX19_05088 in Azospirillum sp. SherDot2

Annotation: Enterobactin exporter EntS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 172 to 196 (25 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 314 to 324 (11 residues), see Phobius details amino acids 371 to 399 (29 residues), see Phobius details PF05977: MFS_3" amino acids 13 to 399 (387 residues), 124.8 bits, see alignment E=3.6e-40 PF07690: MFS_1" amino acids 24 to 359 (336 residues), 97.5 bits, see alignment E=8e-32

Best Hits

KEGG orthology group: None (inferred from 94% identity to azl:AZL_c03400)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>MPMX19_05088 Enterobactin exporter EntS (Azospirillum sp. SherDot2)
MTSAPAAGDSFRSAFRHRAFALFWSARVCSMLAIQMQVVAVGWQVYAMTGDPLDLGLVGL
FQFLPSLALVLVAGHVVDNNDRKTVLFGALSVEMIAVAALFLLTMAGALSPHATFAVVAL
IGLAKSFEGPANQAILSATVPVEDLPNAVAWQSSGVQVAQISGPALGGLLYIAGPAAVYG
VSTAMLLLSVLLIAACRPRPVTMTRRAMSLTSMLAGAAFIRSRPEILGAISLDLFAVLLG
GATALLPIYARDVLHVGPWGLGLLRSAPALGALAMAMVITRWGVKRHAGRWMLIAVAGFG
VATIAFGLSADPVLSFIALLAVGATDQVSMFVRQTLVQLSTPDEMRGRVGAVTSLFIGAS
NQLGEFESGSVAALIGAVPAVVLGGIGAVGLAGLWAAMFPALRRVDRLLGR