Protein Info for MPMX19_05066 in Azospirillum sp. SherDot2

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 12 to 283 (272 residues), 398 bits, E=6.2e-123
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 14 to 626 (613 residues), 792.9 bits, E=1.1e-242
• PF00676: E1_dh
  • amino acids 120 to 184 (65 residues), 32.2 bits, E=1.8e-11
• PF02775: TPP_enzyme_C
  • amino acids 124 to 180 (57 residues), 22.2 bits, 3.3e-08
• PF02779: Transket_pyr
  • amino acids 320 to 481 (162 residues), 144.3 bits, E=9e-46
• PF02780: Transketolase_C
  • amino acids 497 to 620 (124 residues), 92.3 bits, E=6.7e-30

Best Hits

Swiss-Prot: 77% identical to DXS_RHOCS: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 97% identity to azl:AZL_c00990)

MetaCyc: 59% identical to 1-deoxy-D-xylulose 5-phosphate synthase (Arabidopsis thaliana col)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)
• superpathway of ergosterol biosynthesis II (12/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Protein Sequence (637 amino acids)

>MPMX19_05066 1-deoxy-D-xylulose-5-phosphate synthase (Azospirillum sp. SherDot2)
MTATKTPLLDLCPTPAKLRALKPEQLRQFADELRTETVDAVSVTGGHLGAGLGVVELTVA
LHYVFDTPYDRLIWDVGHQCYPHKILTGRRDRIRTLRMGGGLSGFTKRSESEYDPFGAGH
SSTSISAGLGMAVASKIKGEQRNVIAVIGDGSMSAGMAYEAMNNAASTKSRLIVILNDND
MSIAPPVGAMSAYLSRLISSKPYLSLRHLAKEIADQLPRPLRNAARRAEEYARGMVTGGT
LFEELGFYYIGPIDGHNLDHLLPVLQNVRDADDDKPVLIHVVTKKGKGYGPAEESADKLH
AVAKFDVVTGAQSKPKSNAPTYTRVFAQSLIAEAAADPTIVGITAAMPSGTGLDLFGERF
PDRCFDVGIAEQHAVTFAAGMATEGFKPFCAIYSTFLQRAYDQVIHDVVLQHLPVRFALD
RAGLVGADGATHAGSFDTAYLGCLPDIVLMAAADELELMHMVATQAAIDDRASALRYPRG
EGVGLELPDRGSVLPIGKGRILQEGTKIAILSYGTRLGEARRAAAELAARGLSTTLADAR
FAKPLDEDLVRRLALEHEVLITIEEGSVGGFGSFVLQFLATAGLLDGGLKIRPMVLPDTY
LDHDSPVKQYETAGLSAQHIVHTALQALGIESAAARA