Protein Info for MPMX19_05043 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF22029: PhyR_sigma2" amino acids 48 to 98 (51 residues), 33 bits, see alignment E=1.3e-11 PF04542: Sigma70_r2" amino acids 49 to 110 (62 residues), 32.3 bits, see alignment E=1.7e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 53 to 194 (142 residues), 69.5 bits, see alignment E=1.4e-23 PF07638: Sigma70_ECF" amino acids 69 to 196 (128 residues), 32.2 bits, see alignment E=2.5e-11 PF08281: Sigma70_r4_2" amino acids 140 to 191 (52 residues), 58.4 bits, see alignment E=1.1e-19 PF04545: Sigma70_r4" amino acids 147 to 191 (45 residues), 37.9 bits, see alignment 2.6e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 62% identity to rle:RL0788)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>MPMX19_05043 hypothetical protein (Azospirillum sp. SherDot2)
MAIVESGREAYGWSRPVQCRKDRIGPDAMRGSGEIASEAEVRHGLSVTLPRLWRYGFVLS
RQRDWADDLVQQTCLRALERHGQFQPGSRIDHWLFAILNSLWLNEVRARRVRFGQGTVEA
ETSLEVDGARETEAKVLAGQVMRLVGDLPEAQRAAVFLAYVEGLTYREVAAVLDVPVGTV
MSRLAAARAKLADRMSDGAVK