Protein Info for MPMX19_05030 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 253 to 271 (19 residues), see Phobius details PF02625: XdhC_CoxI" amino acids 11 to 72 (62 residues), 63.9 bits, see alignment E=1e-21 TIGR02964: xanthine dehydrogenase accessory protein XdhC" amino acids 19 to 263 (245 residues), 308 bits, see alignment E=2.4e-96 PF13478: XdhC_C" amino acids 120 to 262 (143 residues), 99.5 bits, see alignment E=2.1e-32

Best Hits

KEGG orthology group: K07402, xanthine dehydrogenase accessory factor (inferred from 55% identity to gdi:GDI_2001)

Predicted SEED Role

"Xanthine dehydrogenase, molybdenum binding subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>MPMX19_05030 hypothetical protein (Azospirillum sp. SherDot2)
MMPLSATLSRWLSLDEPAVLVTVAEARGSTPREEGAGMLVGREACAGTVGGGRLEWTAIA
AARRMLEDGSAAETLDLPLGPATGQCCGGHVVLRLERADAGTVAALEELERRARAARPTL
LLFGAGHVGRAMATAFAPLPLRLLWIDGRAQEFPETIPAGVERILTDSPLDPLAAAPAGA
GYLVLTHSHALDFDIAEAALRRGDAAYVGMIGSATKRAKFERWFRARGREVDALAGLTCP
IGAALTGDKRPEVIAALVAAELLVALTLPLPPREREGAQAKLGKGEG