Protein Info for MPMX19_05025 in Azospirillum sp. SherDot2

Annotation: Cytochrome bd-I ubiquinol oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 9 to 37 (29 residues), see Phobius details amino acids 71 to 102 (32 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 9 to 217 (209 residues), 146.2 bits, see alignment E=7.7e-47 PF02322: Cyt_bd_oxida_II" amino acids 10 to 328 (319 residues), 337.5 bits, see alignment E=4.1e-105

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 66% identity to rce:RC1_0416)

MetaCyc: 62% identical to cyanide insensitive ubiquinol oxidase subunit II (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit II" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>MPMX19_05025 Cytochrome bd-I ubiquinol oxidase subunit 2 (Azospirillum sp. SherDot2)
MQEIAEGSLLTLIWVGIVGFAVFMYVLMDGFDLGIGILYPFAPTEEDRDTMMNTVAPVWD
FNETWLVLGGAGLFAAFPIAYAVVLPAMYLPLLVMLIALIFRGVAFEFRFKARAGRHWWN
RSFFVGSLLATFAQGVVLGSFIQGIPVYERQFVGGMLHWLSPFSLFCGAALVVGYALLGA
TWLIWRTIGPLQDWCFRMARRLMLVVLVGVAVVSLWTPFLLPQIALRWFSLPNLFFLAPV
PIVTAVLAFALWRAIDNSREVAPFVLSMALFALSYLGLAISLWPHLIPPGVTVWEAAAPP
KTQVFLLVGMAFLIPSILGYTAYSYWVFRGKVTGAFGYH