Protein Info for MPMX19_05024 in Azospirillum sp. SherDot2

Annotation: Cytochrome bd-II ubiquinol oxidase subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 15 to 43 (29 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 183 to 207 (25 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 319 to 343 (25 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 404 to 428 (25 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 8 to 435 (428 residues), 553.7 bits, see alignment E=1.1e-170

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 65% identity to rce:RC1_0415)

MetaCyc: 56% identical to cyanide insensitive ubiquinol oxidase subunit I (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit I" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>MPMX19_05024 Cytochrome bd-II ubiquinol oxidase subunit 1 (Azospirillum sp. SherDot2)
MDLDPLILSRIQFAFTISFHILFPSFTVGLACWIALLEALWVGTGKGIYRSLSEFWTRIF
ALSFGLGVVSGIVMSYQFGTNWSRWSDTVGNVLGPLIQYEVVTAFFLEAAFLGILLFGRD
RVPRGIHLMAACLVALGTLLSSFWILSANSWMHTPAGFEIKDGRYFVTDWWQVVFNPSFP
YRLAHMVTAMFLTTSFVVAGISAFYLLKRRHFDHARLGLGMALALITVLAPLQIFLGDEH
GLNTLEHQPAKIAAMEGNWEGGPRAPLVLFAIPDVETETNHLEIGIPALSSLILTHDFNG
SVPGLKQFPADERPDPRIVFWTFRLMVGIGFLMLTVAAVHLVLRVRGRLYSSDWFNRILV
GCMPIGFVAILAGWFTTEIGRQPWVVYGHLRTADAVTPSLTAEAALVSLVSFVVAYTLIY
GAGTYYLIRLLHAGPTHAHDAKPPPEAQSPKRPLSAADSSIEAAE