Protein Info for MPMX19_05014 in Azospirillum sp. SherDot2

Annotation: Cytochrome c1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02167: Cytochrom_C1
  • amino acids 34 to 251 (218 residues), 304.2 bits, E=2.9e-95

Best Hits

Swiss-Prot: 48% identical to CY12_SOLTU: Cytochrome c1-2, heme protein, mitochondrial (Fragment) (CYCL) from Solanum tuberosum

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 96% identity to azl:AZL_c04830)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Protein Sequence (253 amino acids)

>MPMX19_05014 Cytochrome c1 (Azospirillum sp. SherDot2)
MRALKTAILSAALALGIAGAAQAAEGVHIPKQNWPHAGIFGTIDKSAAQRGFQIYKEVCS
ACHSMRLVPIRTLAGIGFKEDELKGIAAGYEMQAGPNDAGEMFMRPGLPADRFPSPFAND
QAARASNNGALPPDLSLMAKARVGGEDYLYAFLTGFEEPPADVHVMPGMNYNKVFPGHQV
GMPNILQPDGVTFADGTKATVEQQAHDVATFLTFVAEPHLDARKQMGVKVILFLLVLAGL
MYAAKRKLWSTLH