Protein Info for MPMX19_04974 in Azospirillum sp. SherDot2

Annotation: Nitrobenzene nitroreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00881: Nitroreductase
  • amino acids 18 to 206 (189 residues), 109.7 bits, E=9.2e-36

Best Hits

Swiss-Prot: 40% identical to NBZA_PSEPS: Nitrobenzene nitroreductase (nbzA) from Pseudomonas pseudoalcaligenes

KEGG orthology group: None (inferred from 90% identity to azl:AZL_c05200)

MetaCyc: 45% identical to 4-nitrobenzoate reductase (Pseudomonas putida TW3)
1.7.1.-

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

MetaCyc Pathways

• 4-nitrobenzoate degradation (1/2 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (233 amino acids)

>MPMX19_04974 Nitrobenzene nitroreductase (Azospirillum sp. SherDot2)
MSADSLPLQNALPVLDAVAGRRSVRAFLATPVERETVRHILDLAARAPSGSNIQPWKVHA
IAGEARAALSAELLAAHEAGEPEVPEYPYYPESWREPYLGRRRAVGWALYGSIGIGKGDR
ERMARQHGRNWLFFGAPVGLFFTIDRDMGKGAWLDLGMFMQNLMIVARGFGLETCPQAAF
CYRHAITARHLGLPDGEIIASGMALGFADWSAPENNFPTEREPAERFTRFTGF