Protein Info for MPMX19_04951 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 36 to 301 (266 residues), 131.6 bits, see alignment E=1.6e-42

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 47% identity to rpc:RPC_1663)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>MPMX19_04951 hypothetical protein (Azospirillum sp. SherDot2)
MTTGTNSSRKMAGTAALLALAAVLPLAVTEPSQQNFLILILMGAQMGVAWNIVGGYAGQV
SLGHAVFYGIGAYTSTMLLLTLGLTPWIGALAGGLVAAAFALAMGWPCFRLKGHYFAMAT
IAVAEIMQILVTNSDALEGAVGLYLPMDQSGWGVLIFLSKLPYYYVILGLLVLTVLVSWA
IERSHIGYYFRAIKDEPEAARALGVSLTRYKLIALTVSAFLTAMGGSFYAQKEMFIDPGS
VFATTISIKIALIAILGGVGRLMGPVLGAVILITIEEYSRTLFGSTGSGTDMIIYAAMII
LVAVFSPSGVLGLLGDLRRHLPGAKPAEAKTSAKEIRP