Protein Info for MPMX19_04892 in Azospirillum sp. SherDot2

Annotation: Adenine DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR01084: A/G-specific adenine glycosylase" amino acids 10 to 268 (259 residues), 310 bits, see alignment E=8.2e-97 PF00730: HhH-GPD" amino acids 41 to 159 (119 residues), 69.9 bits, see alignment E=3.2e-23 PF10576: EndIII_4Fe-2S" amino acids 195 to 211 (17 residues), 28.5 bits, see alignment (E = 2.1e-10) PF14815: NUDIX_4" amino acids 238 to 346 (109 residues), 66.7 bits, see alignment E=2.4e-22

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 91% identity to azl:AZL_c00560)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>MPMX19_04892 Adenine DNA glycosylase (Azospirillum sp. SherDot2)
MIPDSIEAARRLLSWYDRHRRDLPWRAKPGETADPYRVWLSEIMLQQTTVPAAAPYFRNF
TERWPTVRDLADSPLDDLLVAWAGLGYYARARNLHKCARVVVDRHGGRFPGNEAALLELP
GIGAYTAAAITAIAFDRKATVVDGNVERVIARIFAVEEPLPNAKPSLRRLAATLTPDFRP
GDYAQAMMDLGATICTPRKPKCMLCPWAEYCEARAAGIAETLPRKVAKAEKPTRRGVAYW
LLNPDGSVLLRRRAEEGLLGGMAEVPSTSWGPDLPGEAAVAAQQPLPARWRRLPGLVRHT
FTHFHLELEVVAGRAGADWRLADGNWVPVDRLGDHALPSVMVKVVRHALSHA