Protein Info for MPMX19_04883 in Azospirillum sp. SherDot2

Annotation: Spermidine-binding periplasmic protein SpuE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13416: SBP_bac_8" amino acids 43 to 330 (288 residues), 78.3 bits, see alignment E=1.4e-25 PF01547: SBP_bac_1" amino acids 44 to 300 (257 residues), 42.1 bits, see alignment E=1.7e-14 PF13343: SBP_bac_6" amino acids 77 to 322 (246 residues), 55 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 45% identical to POTF_ECOLI: Putrescine-binding periplasmic protein (potF) from Escherichia coli (strain K12)

KEGG orthology group: K11073, putrescine transport system substrate-binding protein (inferred from 98% identity to azl:AZL_c00690)

MetaCyc: 45% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>MPMX19_04883 Spermidine-binding periplasmic protein SpuE (Azospirillum sp. SherDot2)
MKKIALSLIGAVAAIAIAGPAMAQAKKPVNIYIWNDYLGETTLADFTKATGAETKVDLYD
SLELLEQKVLVGKSGYDVIVPTAEPTLSRLIQAKVVGPLDKSKIPNYKNLDPKVLKLLEN
SDPGNKYAVPYLGGTVGIAIIPEKIKAVAPDVALDSWDLIFKPEVAKKVAACGITVMDSA
IDVIPSVLNYLGLDPNSEKKEDLDKVEKTLMAVRPYIKRFVTGENINILAGGDACVVMAY
NGDAIQGAARAAEAKSAKVEYITPKEGVQVWWDTLAVPADAPNKDGAYEYINFVLDPANM
ANISNKVSYANAVPASLATVADDIKSNPGIFLPADSKLKLFSLKQIKQATDRARTRVWTK
VKTGK