Protein Info for MPMX19_04860 in Azospirillum sp. SherDot2

Annotation: Type I secretion system membrane fusion protein PrsE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 24 to 440 (417 residues), 370.4 bits, see alignment E=6.6e-115 PF13533: Biotin_lipoyl_2" amino acids 71 to 110 (40 residues), 29.6 bits, see alignment 7.2e-11 PF13437: HlyD_3" amino acids 291 to 399 (109 residues), 51.9 bits, see alignment E=1.8e-17

Best Hits

KEGG orthology group: None (inferred from 93% identity to azl:AZL_c04580)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>MPMX19_04860 Type I secretion system membrane fusion protein PrsE (Azospirillum sp. SherDot2)
MAASDLARPTGKSLSADDATLSLVRATILVLVLLMAALLTWATLMPVKEAVVTAGQVVPS
GNAQVVQHLEGGIVSSILIKEGDLVEAGQPLLVFDPKQVQAEREQMNARLLTLELRAERL
RAFAGGRTPDFARVSGPDTPQTESQVADQTLIYDTQRQARDTAIAVLRAQVSQREAELAL
YEGQLANIKDQITFITGSVDIRNKLESMGLSSKLQSLETQREQSRLMGEQRRIEGQIIAT
GQAITEAGNRILDQSAKLSQDAVTEMGTVTAEIAQLREARAKLDDRAQRLTVLSPVRGLV
QDLRVNTIGAVVPEGGVLMQVVPVDHEMTVEAHVTPRDVGHLQVGQEATVKVLTYDFARY
GAITGKLLRISASTFLDEQHRPYYKAVVALSRNHVGRDDVQHPVLPGMTTQVELPTGERS
LLEYLLKPIYFALSDSFNER