Protein Info for MPMX19_04846 in Azospirillum sp. SherDot2

Annotation: Pyruvate formate-lyase 1-activating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02493: pyruvate formate-lyase 1-activating enzyme
  • amino acids 19 to 248 (230 residues), 312 bits, E=2.2e-97
• PF13353: Fer4_12
  • amino acids 28 to 144 (117 residues), 64.7 bits, E=1.2e-21
• PF04055: Radical_SAM
  • amino acids 37 to 188 (152 residues), 74.2 bits, E=1.5e-24

Best Hits

Swiss-Prot: 44% identical to PFLA_ECOL6: Pyruvate formate-lyase 1-activating enzyme (pflA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 92% identity to azl:AZL_c04450)

MetaCyc: 42% identical to Pfl-activating enzyme (Clostridium pasteurianum)
[Formate-C-acetyltransferase]-activating enzyme. [EC: 1.97.1.4]

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• mixed acid fermentation (14/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.97.1.4

Protein Sequence (255 amino acids)

>MPMX19_04846 Pyruvate formate-lyase 1-activating enzyme (Azospirillum sp. SherDot2)
MTQPPPLPQARPGSVSGWIHSVETGGTVDGPGIRYVLFMSGCPLRCLYCHNPDTQHMHDG
TRTTSAEVLDDIALYATFLQRAHGGLTLSGGEPLVQPEFTAAILRGAKALGLHTALDTSG
FLGNHADDHLLEDVDLVLLDIKAFSEKTYRHLTGVPLRPTLEFAERLAGLNKRIWLRYVL
VPNLTDDAAEIDGLAEFVAGLGVVDRVDVLPFHKMGEHKWKALGRKYMLGDTEPPSRELV
ERVRKQFQAQGLRAD