Protein Info for MPMX19_04840 in Azospirillum sp. SherDot2

Annotation: Leu/Ile/Val-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 25 to 361 (337 residues), 215.3 bits, see alignment E=3e-67 PF13433: Peripla_BP_5" amino acids 28 to 368 (341 residues), 71.1 bits, see alignment E=1.5e-23 PF01094: ANF_receptor" amino acids 48 to 359 (312 residues), 125.2 bits, see alignment E=4.9e-40

Best Hits

Swiss-Prot: 46% identical to LIVB1_BRUSU: Leu/Ile/Val-binding protein homolog 1 (BR1785) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: None (inferred from 95% identity to azl:AZL_c04370)

MetaCyc: 43% identical to L-leucine/L-phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-35-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>MPMX19_04840 Leu/Ile/Val-binding protein (Azospirillum sp. SherDot2)
MRLTVLSFVSATALLAGFGTAQADIVIGLGTATTGPVAALGEQSVYGAKQAVADINAKGG
VLGQKLVLKVGDDACDPRQAVAVANQFVREKVTAVVGHLCSGASIPAADVYQEEGVVMVT
PTATNPLLTAKGHPNIFRVCGRDDQQGVVAGTYLAQTFKGKNVAVLDDKQAYGKGLADVV
VETLEKAGGKVAYRGSVTAGEKDFSALITSLKDKSIDAVYYGGYHPELGLIVRQAQEQGM
KPQFIAGDGLNNQEYWSITGPAGEGTLYTDSASAASDPKAQELIASFKKAGLPEPGNFAF
YSYAAVQVIAEGLQKAGSTDSGKLAKTLHSGSYDTVVGPVEFDKKGDITKPNYVMYVWNN
GQPKMVAQK