Protein Info for MPMX19_04836 in Azospirillum sp. SherDot2

Annotation: Iron-binding protein IscA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 9 to 114 (106 residues), 124.7 bits, see alignment E=8.4e-41 PF01521: Fe-S_biosyn" amino acids 9 to 110 (102 residues), 72.9 bits, see alignment E=1.2e-24

Best Hits

Swiss-Prot: 53% identical to Y484_RICPR: Uncharacterized protein RP484 (RP484) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K13628, iron-sulfur cluster assembly protein (inferred from 96% identity to azl:AZL_c04330)

Predicted SEED Role

"Iron binding protein IscA for iron-sulfur cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>MPMX19_04836 Iron-binding protein IscA (Azospirillum sp. SherDot2)
MARPLPKALTITDAAAERVKALMSKATDDMVGLRIGVKARGCSGLSYDVQYAKEKMKFDE
VVEDKGVTILIDPAAVMFLIGSEMDYVDDKFQTGFVFKNPNEKGRCGCGESFHV