Protein Info for MPMX19_04791 in Azospirillum sp. SherDot2

Annotation: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 117 to 131 (15 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details PF13489: Methyltransf_23" amino acids 30 to 143 (114 residues), 53.6 bits, see alignment E=7.1e-18 PF08241: Methyltransf_11" amino acids 42 to 125 (84 residues), 53.9 bits, see alignment E=7.1e-18 PF13649: Methyltransf_25" amino acids 42 to 122 (81 residues), 36.8 bits, see alignment E=1.6e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>MPMX19_04791 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (Azospirillum sp. SherDot2)
MIDRFATLYRLALDLLLPERTIVRRFIAAHLAGAAPSQSRCLDIGAGPDPYGAALRRALG
PETQFVTVDISPGDRVRAVADVQNLPFADRRFSVVIACHLLQHVTDPRAAVAEAARVLGP
GGLILVVHPFITLQGRDRDLWRWTLDGMTLELQRAGLTPVAARSIGGPLYAVASIMASVP
GRLLVTRRQGWRSGRTPADALRLGFSLLLAAPFHTLARLLEPLDRALWPHAPFHVGGIVL
ARKADHG