Protein Info for MPMX19_04757 in Azospirillum sp. SherDot2

Annotation: L-cystine transport system permease protein YecS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 20 to 48 (29 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 130 to 147 (18 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 17 to 114 (98 residues), 90.6 bits, see alignment E=3.8e-30 PF00528: BPD_transp_1" amino acids 38 to 218 (181 residues), 81.3 bits, see alignment E=3.8e-27

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 72% identity to smd:Smed_2980)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>MPMX19_04757 L-cystine transport system permease protein YecS (Azospirillum sp. SherDot2)
MDLIDTFFNGRVLWDALPLLLMGLGTTLSLGILSIVLGLIGGLALALLRLYGPPVLSGLW
VLYIDLFRAIPILVLLVIVYYALPFVGIRLSPFASATTALSLVSAAYSAEILRAGIQAIP
RGQFEASQALGLSYWSMMGDIVLPQAVRIVIPPMTSNCINVMKDTALASVVAMPDLLKQA
TQAQALAANPTPLIGAAALYVLLLLPMVRAVGTLERHFARERR