Protein Info for MPMX19_04756 in Azospirillum sp. SherDot2

Annotation: Glutamine transport ATP-binding protein GlnQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF00005: ABC_tran" amino acids 45 to 192 (148 residues), 133 bits, see alignment E=1.8e-42 PF13304: AAA_21" amino acids 163 to 222 (60 residues), 28 bits, see alignment E=3.3e-10

Best Hits

Swiss-Prot: 61% identical to GLNQ_GEOSE: Glutamine transport ATP-binding protein GlnQ (glnQ) from Geobacillus stearothermophilus

KEGG orthology group: None (inferred from 71% identity to smd:Smed_2981)

MetaCyc: 56% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>MPMX19_04756 Glutamine transport ATP-binding protein GlnQ (Azospirillum sp. SherDot2)
MQINDIQPGDMQAGEAGRAASAPPAGRPIIAIRDLRKMYGSFCALSGINLDVGEGEVVVL
LGPSGSGKSTLIRCINLLETYDSGTVTVDNVAVRPGPNLAAVRSEVGMVFQSFNLFPHMT
VLRNVALAPIRVRKLAPKAAEERAMELLTRVGIAEQAGKFPGQLSGGQQQRVAIARALAM
EPKILLFDEPTSALDPEMVGEVLDVMQSLARTGVTMVIVTHEMGFARRVADRVIFMERGQ
IVEEAKPEAFFSAPREERARAFLQAVLNH