Protein Info for MPMX19_04754 in Azospirillum sp. SherDot2

Annotation: Cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 TIGR01976: cysteine desulfurase family protein" amino acids 11 to 409 (399 residues), 409.7 bits, see alignment E=8.5e-127 PF00266: Aminotran_5" amino acids 26 to 405 (380 residues), 215.9 bits, see alignment E=1.3e-67 PF01041: DegT_DnrJ_EryC1" amino acids 66 to 224 (159 residues), 29.7 bits, see alignment E=5.9e-11 PF00155: Aminotran_1_2" amino acids 69 to 200 (132 residues), 37.1 bits, see alignment E=3.3e-13

Best Hits

KEGG orthology group: None (inferred from 55% identity to smd:Smed_2982)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7)" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>MPMX19_04754 Cysteine desulfurase (Azospirillum sp. SherDot2)
MSNVTTSPLDLSFVRAQFPALAGDWIFMDNAGGSQTLTRVADRIRDYLLTSNVQLGASYA
VSRKSGARVADAHADIAELIGAARPDEVVMGGSTTALLYTLSAAMADRIRPGDEIVVTNC
DHEANIGPWRKLEEKGAVIRTWAVRPDSLELALDDLESLLNGRTRLVCVTHASNILGTIN
PVADIARLVHRHGAKLLVDAVAYAPHRALDVAGWDVDYYVFSFYKVYGPHFAVLYGKHEH
LAALPSLNHYFIDQTVIPYKLQPGNVNYELAVGCTGIVDYLAELGERCGATGPRRARIEA
AFDAIAAHEEALAERLLAYLRGRNDVKVIGHAAADRSLRVPTISFVVDGYRSDEVVSAVD
ASMIGIRFGDFYAKRLVETLGLAAVNGVIRVSLLHYNTLDEVDRLIDALGSAMPQRR