Protein Info for MPMX19_04743 in Azospirillum sp. SherDot2

Annotation: Formyltransferase/hydrolase complex subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01913: FTR
  • amino acids 1 to 146 (146 residues), 190.4 bits, E=1.5e-60
• TIGR03119: formylmethanofuran--tetrahydromethanopterin N-formyltransferase
  • amino acids 8 to 299 (292 residues), 422.6 bits, E=4.4e-131
• PF02741: FTR_C
  • amino acids 149 to 299 (151 residues), 191.4 bits, E=9.2e-61

Best Hits

Swiss-Prot: 64% identical to FTR_METCA: Formylmethanofuran--tetrahydromethanopterin formyltransferase (ffsA) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K00672, formylmethanofuran--tetrahydromethanopterin N-formyltransferase [EC: 2.3.1.101] (inferred from 64% identity to mca:MCA2858)

MetaCyc: 44% identical to formylmethanofuran--tetrahydromethanopterin N-formyltransferase (Archaeoglobus fulgidus DSM 4304)
Formylmethanofuran--tetrahydromethanopterin N-formyltransferase. [EC: 2.3.1.101]

Predicted SEED Role

"Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101)" in subsystem Methanogenesis (EC 2.3.1.101)

MetaCyc Pathways

• methyl-coenzyme M oxidation to CO₂ II (4/6 steps found)
• methanogenesis from H₂ and CO₂ (3/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (3/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (3/6 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (11/18 steps found)
• methoxylated aromatic compound degradation II (4/9 steps found)
• superpathway of methanogenesis (5/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.101

Use Curated BLAST to search for 2.3.1.101

Protein Sequence (301 amino acids)

>MPMX19_04743 Formyltransferase/hydrolase complex subunit D (Azospirillum sp. SherDot2)
MLLNGIHIESTYAEAFDMKATRLIVTADTPAWARHAGGAATGFATSVIACGCEAGIEREL
APEETPDGRPGVSLLFFATGRSVLGKQVETRVGQCILTCPGTACFAGVPRGVTEDLIPLG
RKLRYFGDGQQMSKLLGGRRYWRIPVMDGEFLCEESSWSVPAVGGGNLLILADARMAALE
AAEAAADAMRAVPNVVLPFPGGVVRSGSKIGAKYKGMPASTNDAYCPTLRGLPRSRLPAE
VESVLEIVIDGLTAADVAAATTAGLKCLIERGRGSGIWGVTAGNYGGKLGRHHFHLHELL
P