Protein Info for MPMX19_04739 in Azospirillum sp. SherDot2

Annotation: NAD(P)-dependent methylenetetrahydromethanopterin dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF09176: Mpt_N" amino acids 18 to 98 (81 residues), 116.5 bits, see alignment E=2.4e-38

Best Hits

Swiss-Prot: 48% identical to MTDB_METEA: NAD(P)-dependent methylenetetrahydromethanopterin dehydrogenase (mtdB) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K10714, methylene-tetrahydromethanopterin dehydrogenase [EC: 1.5.1.-] (inferred from 63% identity to mfa:Mfla_1660)

MetaCyc: 48% identical to MtdB (Methylorubrum extorquens AM1)
1.5.1.-

Predicted SEED Role

"Methylene tetrahydromethanopterin dehydrogenase (EC 1.5.99.9)" in subsystem One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.99.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-, 1.5.99.9

Use Curated BLAST to search for 1.5.1.- or 1.5.99.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>MPMX19_04739 NAD(P)-dependent methylenetetrahydromethanopterin dehydrogenase (Azospirillum sp. SherDot2)
MEKPYIMHAITPVKAVSPFDINMACDAGYGIIVPYTNVETGEVPGLVQDMIFSRAPGDAK
RTGLFIAGRDILTALDMLEAARRAMVPPFEISVFADPSGAYTTAAAMIAKVEAQLEKVGL
ALAGSRVAVFGGKGPVGGVAAVLAARAGASVQLVGHDGAASVTERATSYRQRFGVTLGAV
DGSTDAHKAAILAETDVVLAVARAGVQVLSRAQIAAAPSVRVVADVNAVPPAGVEGVDAF
SDGVAIDGTDAVGIGALAIGNVKFKTQHGLFKAMREAAKPVYLAFDDAFVLARAQCRKAA