Protein Info for MPMX19_04720 in Azospirillum sp. SherDot2

Annotation: HTH-type transcriptional activator RhaS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 79 to 205 (127 residues), 32.9 bits, see alignment E=8.4e-12 PF00165: HTH_AraC" amino acids 260 to 297 (38 residues), 27.6 bits, see alignment 3.7e-10 amino acids 312 to 351 (40 residues), 34.2 bits, see alignment 3.3e-12 PF12833: HTH_18" amino acids 275 to 351 (77 residues), 81.9 bits, see alignment E=5.1e-27

Best Hits

KEGG orthology group: None (inferred from 94% identity to azl:AZL_c01780)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>MPMX19_04720 HTH-type transcriptional activator RhaS (Azospirillum sp. SherDot2)
MAVKRGPSDWEGVLVGKTVEYRRFGGSGPAPRQEERALLSVGFILTNNFTLTALAPFIDA
LRLAADEGDRSRQIRCRWTIMGSRAEPVMSSCGIGVARWEPLTDPRRFDYVVVVGGLLHA
GPQLDDETLAYLRAAASYGVTLVGVCTGSFVLSRIGLMKNRRCCVSWYHHRDFIEEFPDL
VPVADQLYVVDRDRITCSGGAGVADLAAFLIERHLGRATAQKTMHILLIDKARPASQSQP
QPPTVVEITNDRVRRALLLMEQHISDPLSVEEIVHRLNVSTRQFERLFRLAVGTSPATYY
RSLRLRYGHWLLRNTKRSVTAIANEAGFADCAHFSRQFRELFGVSPSEVRRTAGPDAEAD
PHFSPLAAFRRTNANSLLPDRRLFEDPEPIVRDAAQVD