Protein Info for MPMX19_04678 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01547: SBP_bac_1" amino acids 44 to 286 (243 residues), 52.6 bits, see alignment E=1.4e-17 PF13531: SBP_bac_11" amino acids 49 to 289 (241 residues), 45.8 bits, see alignment E=1.3e-15 PF13416: SBP_bac_8" amino acids 51 to 307 (257 residues), 84.3 bits, see alignment E=2.6e-27 PF13343: SBP_bac_6" amino acids 131 to 333 (203 residues), 92.7 bits, see alignment E=5.2e-30

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 84% identity to bja:bll3286)

Predicted SEED Role

"ABC transporter substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>MPMX19_04678 hypothetical protein (Azospirillum sp. SherDot2)
MLLTRRNLMQTALTLGAMHAFPGLTWAQARPLVFATFTGSWEEAHKAVLVPAFRKAAGNA
NIVLDPMLSVDQIAKVNAARSNPPIDVMLHDPGPALQAIAQDLVEPYPVEQSAYYKDLIP
AAQVPMGPAPFFQVVGITYNPETVKTPPTSWADLWKPEFKGRVGITNLNSTLGTGFMVEL
AKMHGGSEANIDPAFKAIEALRPSLAAVAANPGQLATLFQQGQIDISPGNFNAIQILKAR
GVPVEFVIPKEGAIAFKTTIHIVKNSPNKELAFKLIEAAMSPEVQATLMEEPYLIVPTNT
KVAIKGELAKTLAKDHAEIAKKFVFQDWGKINEQRAAWIERFNREIRV