Protein Info for MPMX19_04677 in Azospirillum sp. SherDot2

Annotation: Sulfate/thiosulfate import ATP-binding protein CysA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF00005: ABC_tran" amino acids 33 to 175 (143 residues), 132 bits, see alignment E=3.6e-42 PF08402: TOBE_2" amino acids 292 to 361 (70 residues), 40.9 bits, see alignment E=2.7e-14

Best Hits

Swiss-Prot: 47% identical to POTA_RUEPO: Spermidine/putrescine import ATP-binding protein PotA (potA) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 66% identity to azc:AZC_1972)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>MPMX19_04677 Sulfate/thiosulfate import ATP-binding protein CysA (Azospirillum sp. SherDot2)
MVSASPNGPASPRGQTLLLDGITQRYGTSLAVNEVTLDIRGGELVALLGPSGCGKTTLLR
IIAGFLAQTKGHVMVGGKSVDGLPPNRRSVGIVFQNYALFPHMTVAENVAYGLDARGADR
ATQRSEAQRMLDLVKLGHLGDRTPRQLSGGQQQRVALARALAVNPSILLLDEPFAALDKN
LRLDMQIEVKRIQRLSGITTILVTHDQEEALSMADRVAVLSQGKLEQFSPPTEIYDTPDS
LFVNTFVGSANLLGGVLVDSDRSSGRVRLDAGGLIETRAPKGDLRPGSRVTVCLRPEHLS
VDPATGDTETLNGVVEMGLPLGATVVHEIRVGDGTAVKVSEPRIQRTDLLAPGTPVRLAP
VAPRLASVFAAA