Protein Info for MPMX19_04657 in Azospirillum sp. SherDot2

Annotation: 2,3-dimethylmalate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 47% identical to PRPB_AERPE: 2-methylisocitrate lyase (prpB) from Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)

KEGG orthology group: None (inferred from 75% identity to met:M446_1933)

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
superpathway of glyoxylate bypass and TCA (11/12 steps found)
glyoxylate cycle (6/6 steps found)
superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)

KEGG Metabolic Maps

Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.1

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>MPMX19_04657 2,3-dimethylmalate lyase (Azospirillum sp. SherDot2)
MTMPDLSFKQRLSEDRVVLAPGVYDAFTASMATAAGFEALYLSGAAIAYTRLGRPDIGLV
SVSEVADTIALVRDRVPTPLIVDADTGYGNALNVQRTVRMFERAGATALQLEDQSFPKRC
GHLTDKAVIPAGEMAGKIKAAVDARTSEGTLIVARTDAVAVEGVSAALDRARLYVEAGAD
VLFVEAPKSREQLSAIASDLGGIRPLLANMVEGGQTPISSAADLAELGYRLVIFPGGIVR
ALARQAQDYYGSLAQHGTTQPFRDRMFDFNALNDLIGTPEMLALGETYKDFGPAKREDAA