Protein Info for MPMX19_04643 in Azospirillum sp. SherDot2

Annotation: Serine/threonine-protein kinase PknD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 562 to 582 (21 residues), see Phobius details PF13672: PP2C_2" amino acids 23 to 207 (185 residues), 59.9 bits, see alignment E=7.9e-20 PF07228: SpoIIE" amino acids 94 to 244 (151 residues), 34.1 bits, see alignment E=8.1e-12 PF00481: PP2C" amino acids 182 to 236 (55 residues), 21.1 bits, see alignment 6.8e-08 PF07714: PK_Tyr_Ser-Thr" amino acids 281 to 531 (251 residues), 77.6 bits, see alignment E=3.1e-25 PF00069: Pkinase" amino acids 306 to 531 (226 residues), 116 bits, see alignment E=6.2e-37 PF06293: Kdo" amino acids 350 to 422 (73 residues), 25.8 bits, see alignment E=2e-09

Best Hits

KEGG orthology group: None (inferred from 64% identity to rpx:Rpdx1_2231)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (584 amino acids)

>MPMX19_04643 Serine/threonine-protein kinase PknD (Azospirillum sp. SherDot2)
MSGAGIVKELRISIGQWSDKGRKETNQDFHGALIPVAPLLGMKGIAVALADGISTSRVSH
IASESVVKSFLTDYYCTPESWSVRMAAQRVLAATNSWLHAQNRRSEYRYDQDRGYACTLS
ALVLKSATAHLFHVGDSRIYRIAGRSLEQLTDDHRVVVSSEVSYLGRAMGVVPHVEIDCR
ELPVEPGDVFLLATDGVYDHIDAEFLISTIDRHPDDLDLAARFAVEEALRRGSTDNLTLQ
IVRIEAVPDADAGDLFHRLSDLPLPPLLEPRTEFEGYRILRELHASSRSHVYLAQDGAGG
SGGAPAVALKVPAIDRRDDRAHLRRFLMEEWIARRLNSPHVLKPPPQSRPRRHLYVVTEY
IEGQTLTQWMRDHPDPDLPAVRAIVEQIGKGLQAFHRLEMLHQDLRPDNVMIDGTGTVKI
VDFGSVLVPGILETMPDADRGEILGTLQYTAPEYLLGEGGTPASDLYALGVIAYQMLTGR
LPYGADAATATTRARQRKLVYRTALDDRRAVPAWIDGVLRRAVHPDPAKRYQELSEFLYD
LRHPRKQAAGTRRRPLIERNPLAFWQGLSVLLALAVLILLAGRV