Protein Info for MPMX19_04628 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 53 to 78 (26 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details amino acids 302 to 326 (25 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details amino acids 389 to 411 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 21 to 284 (264 residues), 43.3 bits, see alignment E=3.3e-15 PF13440: Polysacc_synt_3" amino acids 42 to 332 (291 residues), 27 bits, see alignment E=2.7e-10

Best Hits

KEGG orthology group: None (inferred from 89% identity to azl:AZL_c02650)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>MPMX19_04628 hypothetical protein (Azospirillum sp. SherDot2)
MLKGLTGRTAAAKRNSFARQGVATVLVTAATMALGLLTGILVARTIGPDGRGALTAVLTT
VQLLGWLFGMGCGKAVTYALSRDHAAGGRLLSTWTLILLPVAAVAIGVGYLLLPTLLAAQ
PAETLALARLYLPMIAMALLSELMLGLILGDQDFRSFNALNFLQPAGVAIVYAALWATGR
FTVEAAVIVQAAMSTLVLVVATALLVRRHGIGRPDPALGRQTVWYALRTHGDVVGGVITQ
RLDLLIIPAFLSAAQVGLYALATSLSWLIVSLSGALATVVMPAATRRGQSGRALVLNSLQ
ATFAIGGLLGGGLFVFADIAIGLVYGPSFADSALPLRLLLPGAILYAAASILLNGLYAEN
RPFTATLANLLGMVVTLGGLLLFLRSGGILAAAIVSTVAYTLVFATAATLYRHATGLPWR
VFLPDPAMLAALPRRLFDKPAPAAAAPALTPVATPASPAGK