Protein Info for MPMX19_04584 in Azospirillum sp. SherDot2

Annotation: Lipopolysaccharide export system ATP-binding protein LptB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR03411: urea ABC transporter, ATP-binding protein UrtD" amino acids 8 to 248 (241 residues), 376.4 bits, see alignment E=3.3e-117 PF13476: AAA_23" amino acids 18 to 55 (38 residues), 27.4 bits, see alignment 9.9e-10 PF00005: ABC_tran" amino acids 24 to 178 (155 residues), 106.2 bits, see alignment E=4.3e-34 PF12399: BCA_ABC_TP_C" amino acids 225 to 248 (24 residues), 28.7 bits, see alignment (E = 1.5e-10)

Best Hits

Swiss-Prot: 35% identical to BRAF_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraF (braF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 86% identity to sno:Snov_2423)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtD" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>MPMX19_04584 Lipopolysaccharide export system ATP-binding protein LptB (Azospirillum sp. SherDot2)
MANPTDYLLAVEGLTVSFDGFKAVNDLSFYVDSNEIHVIIGPNGAGKTTVLDLICGRTRA
SGGSIKFRNRELTAMKEHQIVTAGVGRKFQNPSIYDDLTVFENLEISYPRGRSVFGALAF
KRDAAVRERVAEIAEMIFLADHLDQRAEYLSHGQKQWLEIGMLLIQDPELLMLDEPVAGM
SVNERKKTAELLNKIIQNRSVLVIEHDMKFVEDIAHRVTVLHQGKILSEGSMERVKNDPK
VVEVYLGH