Protein Info for MPMX19_04574 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 668 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 77 (28 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 263 to 279 (17 residues), see Phobius details amino acids 286 to 301 (16 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 399 to 423 (25 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details amino acids 465 to 484 (20 residues), see Phobius details amino acids 492 to 510 (19 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (668 amino acids)

>MPMX19_04574 hypothetical protein (Azospirillum sp. SherDot2)
MPSLSLAALCIATGLVLWMASGYALARSLAFDRAVALALAPVLGWAVQNALALLLSLVVG
FSPVATVGAVALICAAGLLRGRRDGSGSDQSIPPLTLWVCLAAAIMAAGPALAVLPKFTG
DGVAVAPALFDHAKIALIDQIVREGVPPVNPVYGGAEAPAGVAYYYLWQFGAAQLAQLTG
ATGWEADAAASWLTAFSTLLLMAGLACHFSGSSLAPFLAIGLSGLGSLRPVLAAMVGEET
LEHWLQPATGLAGWLFQTSWSPHHVQAAGCVVVAVMTMVRLARQPGALTTVTLALLAAAA
YQSSIWVGGVVFALAAAGCALFLARSRPARSHPAGGAGTFLLLGGIAAVVAIAIASPLLV
EQYRSAVARGGGRLIAIDPFEVLGPALPQPLGRVLDVPAYWLVLLVVEFPLVYLAGAITL
ARMAARPDAPPDGPLVRALAILTAASLGTGWLLVSTTGVNNDLGWRAVLPGLMVLTAAAA
AGLARCMERRAALPLVLAMAAATATLPDGLRLATENLVGKPSPSAAAFARSPALWQAVRR
HAPPDARVASNPALFADMTPWPVNLSWALFANRRSCFAGNELAIAFAALSSERRTAVADQ
FRRVFAGDGTPDDIRALARTHRCDVVAVTVFDGAWSHDPFAASPFYRLAETEPGLWRIYS
ADPRMAGN