Protein Info for MPMX19_04550 in Azospirillum sp. SherDot2

Annotation: L-cystine transport system permease protein YecS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 20 to 49 (30 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 18 to 113 (96 residues), 109.9 bits, see alignment E=3.8e-36 PF00528: BPD_transp_1" amino acids 37 to 218 (182 residues), 76.3 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 41% identical to YECS_ECOLI: L-cystine transport system permease protein YecS (yecS) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 76% identity to vei:Veis_0724)

MetaCyc: 41% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>MPMX19_04550 L-cystine transport system permease protein YecS (Azospirillum sp. SherDot2)
MTSGWNWDGFFEYLFNGYLFSGAITTLWLTLAGIAGGLVVGCVLGLLRLSPYRWVARVAQ
TYIWVFRGTPLLVQLIIIYTGLPQIGIKLSVTESALIGLILNEAAYLAEIIRGGILGVAA
GQSNAGRALGLNSAQVMAYIVLPQAVRIIIPALGNSVNGLLKTTSVTSVISMEELLRSTQ
LLIQERFMVLELFTVAALYYLLMTSLWDIVQRRIERHFGRAYRNIAIVDGQ