Protein Info for MPMX19_04530 in Azospirillum sp. SherDot2

Annotation: p-hydroxybenzoic acid efflux pump subunit AaeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 45 to 238 (194 residues), 107.5 bits, see alignment E=3.3e-35 PF13533: Biotin_lipoyl_2" amino acids 46 to 93 (48 residues), 55.1 bits, see alignment 1e-18 PF16576: HlyD_D23" amino acids 46 to 233 (188 residues), 51.7 bits, see alignment E=1.5e-17 PF13437: HlyD_3" amino acids 155 to 238 (84 residues), 35.9 bits, see alignment E=2.2e-12 PF00529: CusB_dom_1" amino acids 158 to 285 (128 residues), 28 bits, see alignment E=3.3e-10

Best Hits

Swiss-Prot: 40% identical to AAEA_PECCP: p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: None (inferred from 76% identity to pba:PSEBR_a2168)

Predicted SEED Role

"possible FusE-MFP/HlyD family membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>MPMX19_04530 p-hydroxybenzoic acid efflux pump subunit AaeA (Azospirillum sp. SherDot2)
MKAVLSLLGRYALTLCFGTAAAVVALQVWNRHEQTPWTRDARVSAEVVQIAPEVSGTVGA
VSVADNQYVHRGDVLYAIDPRRFSLAVASAQAEAEARRQDMLVRQAAARRRSQLREVISQ
EDVQQTAGAAAQAAATYDGAVAALDLAKLNLARATIRAPVDGYVTNLRLRPGDYATAGVT
KIAILDATSFWITSYFEETKLRRIRVGSPAQIMLMGFDEPLSGHVESIGRGIEDSNGTPG
HLGLPNVEPTFSWVRLAQRIPVRIRIDRVPPGVELAAGMTATVAIGSATAADAL