Protein Info for MPMX19_04512 in Azospirillum sp. SherDot2

Annotation: C4-dicarboxylate transport transcriptional regulatory protein DctD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 102.6 bits, see alignment E=3.6e-33 PF00158: Sigma54_activat" amino acids 141 to 307 (167 residues), 224.3 bits, see alignment E=1.9e-70 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 72.3 bits, see alignment E=1.2e-23 PF07728: AAA_5" amino acids 164 to 279 (116 residues), 30.6 bits, see alignment E=7.8e-11 PF02954: HTH_8" amino acids 401 to 439 (39 residues), 52.3 bits, see alignment 9.1e-18

Best Hits

Swiss-Prot: 55% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 56% identity to azo:azo0447)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>MPMX19_04512 C4-dicarboxylate transport transcriptional regulatory protein DctD (Azospirillum sp. SherDot2)
MTVLLIDDDPEVLDSSRQTLELEGFAVEAVTEPEAGLARLGASWPGVVVTDVRMPGMDGF
ALLERVRAADAEVPVVLVTGHGDIAMAMRAVREGAYDFIEKPAEPDHLVEVVRRALAHRG
LVLENRRLRAQLAEGGPKGRIIGRSPVIEHLRAAVANLADAEVDVLLFGETGTGKELVAR
SLHEGGRRRAGNFVALNCGAMPDTIIESELFGHEPGAFTGAQARRIGKLEYAAGGTLFLD
EIESMPMHLQVKLLRVLQERAIERIGGNRTIPLDLRVVAATKVDLLRLAAEGKFREDLYY
RLNVVTVPLPPLRERRGDVALLFRHFLDAALARSRRTPPPLDPALLARLAAHGWPGNVRE
LRNVAERVALGLGDGLAPVGVTAGTAGMAGSAEIEPLADRLDRVEKQLIEDALARCGGRV
GETAEQLGITRKTLYLKMRHHGLSRDDFAEE