Protein Info for MPMX19_04495 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 237 to 265 (29 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 29 to 381 (353 residues), 148.6 bits, see alignment E=2.6e-47 PF01061: ABC2_membrane" amino acids 236 to 348 (113 residues), 37.4 bits, see alignment E=2.1e-13

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 90% identity to azl:AZL_b02410)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>MPMX19_04495 hypothetical protein (Azospirillum sp. SherDot2)
MRPRTGLRPGFLLVFQRELVWLRRRRPGLLVLVTLLPLGLMGLLMAIFSAGLATRLPVAV
LDFDGSDLSRTIVRTVDATPDAAVARRVADLAEGRRLILSGAVHGLLMIPRDLERDVKAA
RRPEVVFFYNAQTLSTGNLVLRGISNAVPTVAAGIRLSLRTAQGQPMDAAQASLAPIPVQ
VHGLFNPTMNYAHFLLAALLPSLLQVVVVVASAYSVGLDVETRHRLAILRRLGGGLWPAL
AGKVLPYTILSVMVLGLADSVLFGLLDLPLRGQRGILLLAGILFLLACQLLGILLALLLR
STAMAVSIGTLLTAPAFGFMGIGFPRLGMGGFAQGYGALLPGTWYLTARIDQTVRGTPSD
LSWPPVLVLAAFVIGLAGLTAWRLEGLRARRRRAGTGPTAAVHGGAAS