Protein Info for MPMX19_04422 in Azospirillum sp. SherDot2

Annotation: Benzoate--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 285 to 307 (23 residues), see Phobius details PF00501: AMP-binding" amino acids 96 to 438 (343 residues), 224.7 bits, see alignment E=1.7e-70 PF13193: AMP-binding_C" amino acids 493 to 571 (79 residues), 91 bits, see alignment E=7.5e-30

Best Hits

KEGG orthology group: K08295, 2-aminobenzoate-CoA ligase [EC: 6.2.1.32] (inferred from 95% identity to azl:AZL_a03650)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>MPMX19_04422 Benzoate--CoA ligase (Azospirillum sp. SherDot2)
MKGCAFAPADGMAVSEPRVWRPGPPTDHAGPVLPVLQRGEMTQRMMPSGHLDSFTRDRLP
APSQRPDLILDRPELQYPQRLNAVSVLIDGWRERGWDGRPCLIGGDGEVWSYGRMRDTVD
RIARVLTEDYGMVTGNRVLLRGPNTPMLAACWLAVIKAGGVLVPTMPLLRAPELADVLKR
ASIDMALCDTHFLDDLEEAALPSLRIVGFRDGELEHRIATKPPGFEAADTAQDDVALIAF
TSGTTGTPKAAAHLHRHLLAISDLSPRSVLGTTAEDVFCGSPTLAFAYGLGGLLLFPLRI
GASVILLERGTADRLIEAATRHKATVMFTVPTVYRGMIGRMAADPALAKGLSGLRLCISA
GEPLPQQTFEGWRDATGLEILDSLGTTELLNAVLHAVPGNVRPGSTGKPVPGYEAMVVDD
QFRRLPPGQVGRLAVRGATGCLYLDDPRQESYVQQGWNLTGDAFHVDEDGFFWYHARTDD
LIVSAGYKISGLEVENILLSHDAVQECAVIAAPDPVRGTIPKAFVVLRDDVRPDERLAEE
LQSFVKEHIAPYKYPRAVEFLDALPRTETGKVQRFKLRRRAWQPDEAE