Protein Info for MPMX19_04416 in Azospirillum sp. SherDot2

Annotation: Dipeptide transport ATP-binding protein DppD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF00005: ABC_tran" amino acids 24 to 182 (159 residues), 92.7 bits, see alignment E=3.2e-30 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 231 to 315 (85 residues), 76.4 bits, see alignment E=7e-26 PF08352: oligo_HPY" amino acids 234 to 297 (64 residues), 66.4 bits, see alignment E=2.4e-22

Best Hits

Swiss-Prot: 61% identical to DPPD_SHIFL: Dipeptide transport ATP-binding protein DppD (dppD) from Shigella flexneri

KEGG orthology group: K12371, dipeptide transport system ATP-binding protein (inferred from 98% identity to azl:AZL_a03710)

MetaCyc: 61% identical to dipeptide ABC transporter ATP binding subunit DppD (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>MPMX19_04416 Dipeptide transport ATP-binding protein DppD (Azospirillum sp. SherDot2)
MPLLDIKNLSVEFTTRAGTFRAVDGIDLTVDEGEVVGIVGESGSGKSVTSLAVMGLLGSN
GRVVADRMMFGGRDLLTMSAAQRRKITGKDVAMVFQEPMTSLNPCFTVGFQIMETLRVHE
GLSGKALRNRAIALLEQVGIPAPETRLSAFPHQLSGGMNQRVMIAIAIACNPRLLVADEP
TTALDVTIQKQILDLLVQLQRERGMALILITHDMGVVAETAQRVVVMYAGQVAETRPVQS
LFERPRHPYTGALLDALPERALGKRRLPTIPGMVPGIADRPAGCLFSPRCRFADARCRAE
RPALFDVDDGRARCFYPLPDGHPAAGEAL