Protein Info for MPMX19_04372 in Azospirillum sp. SherDot2

Annotation: Phospho-2-dehydro-3-deoxyheptonate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01358: 3-deoxy-7-phosphoheptulonate synthase
  • amino acids 5 to 447 (443 residues), 746.4 bits, E=4.1e-229
• PF01474: DAHP_synth_2
  • amino acids 5 to 441 (437 residues), 720.2 bits, E=3.7e-221

Best Hits

Swiss-Prot: 61% identical to AROF_ARATH: Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic (DHS1) from Arabidopsis thaliana

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 98% identity to azl:AZL_a04070)

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase II (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.54

Protein Sequence (463 amino acids)

>MPMX19_04372 Phospho-2-dehydro-3-deoxyheptonate aldolase (Azospirillum sp. SherDot2)
MVERWTPASWRTKPAKQLPTYPDLSKVEAVEQRLSSYPPLVFAGEARRLKAKLAEAAAGQ
AFLLQGGDCAESFAEFHPNNIRDTFRVLLQMAVVLTFGASIPVIKVGRMAGQFAKPRSAD
MEAIDGVELPSYRGDIVNGFDFTSDARVPDPERMMQAYTQAAATLNLLRAFAQGGYADLH
KVHQWTLSFVEKSPAGEHFQELATRLDETLAFMAACGITAETTPQIRETDFFTSHEALLL
PFEQALTRVDSTTGDWYDVSAHMLWIGDRTRQPDGAHVEFLRGVKNPIGLKCGPTTDPDE
LIRLIDILNPTNEAGRLTLIVRMGSDKVAEKFPPLLRKVQREGRTVVWSCDPMHGNTIKS
TTGYKTRPVERVLAEARGFFEVHQAEGTHAGGVHFELTGQDVTECTGGAQAITDHNLALR
YHTACDPRLNASQSLELAFLLSEKLKEGRQSREARRRAAVAAE