Protein Info for MPMX19_04264 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 55 to 75 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 70 to 225 (156 residues), 78 bits, see alignment E=3.9e-26

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 91% identity to azl:AZL_a05760)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>MPMX19_04264 hypothetical protein (Azospirillum sp. SherDot2)
MPALMPVVSILLLLALWQAAAMTVGGRLLPGPPVVAEALLREAESGALFHHMGVTLLRVL
AAFALAMSIGVGIGLPMGRSPVIDRLFGPWLVFFLNLPALVVIVLAYVWFGLTEAAAIGA
VAINKIPNTVVLVRAGARAIDEGLVDMARVYRLSPADRLRHVLLPQLTPTIAAAARSGLA
LIWKIVLVVELLGRSDGVGFQINLLFQTFDVAGILAYTIAFVAVVQLLEYGVLQPAERHC
QRWRRMPADA