Protein Info for MPMX19_04238 in Azospirillum sp. SherDot2

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 278 (270 residues), 148 bits, see alignment E=1.5e-47

Best Hits

KEGG orthology group: None (inferred from 64% identity to mag:amb2602)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>MPMX19_04238 High-affinity branched-chain amino acid transport system permease protein LivH (Azospirillum sp. SherDot2)
MFELTLQALFSGLLAGGYYATVAVGLALVFGTMRVINLAHGELVLLAAYVAYAAETNYGV
NPVMAIPVALVIVGSASAIVYALLSRIRQDREINSLILTFGLGIILTNAILSIWKADIHS
TSDPWFQDSLVVADTLFAMNAEVASFVGGLVLMAGVWWWLNHSWQGRAVRALSSDRAAAT
LMGVNPRKIEILSFLIAALLATFAGFAIYTGKTVFPALGHVLTVKAFIITVLAGMGSIPG
VLIGAVMIGVIESLTVTYLSASLQELAGMILFLVVLFVSPSGLFGGGRALAR