Protein Info for MPMX19_04212 in Azospirillum sp. SherDot2

Annotation: Photosystem I assembly protein Ycf3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13432: TPR_16
  • amino acids 8 to 65 (58 residues), 20.8 bits, 3.7e-07
  • amino acids 44 to 94 (51 residues), 17.4 bits, see alignment (E = 4.4e-06)
  • amino acids 111 to 172 (62 residues), 34.8 bits, 1.6e-11
  • amino acids 151 to 207 (57 residues), 28.9 bits, 1.1e-09
  • amino acids 215 to 273 (59 residues), 23.1 bits, 6.9e-08
  • amino acids 248 to 295 (48 residues), 29.6 bits, see alignment (E = 6.3e-10)
  • amino acids 280 to 329 (50 residues), 34.6 bits, see alignment (E = 1.8e-11)
  • amino acids 662 to 725 (64 residues), 25.7 bits, 1.1e-08
  • amino acids 707 to 746 (40 residues), 22.9 bits, see alignment (E = 8.4e-08)
  • amino acids 810 to 862 (53 residues), 22.3 bits, see alignment (E = 1.3e-07)
• PF14559: TPR_19
  • amino acids 16 to 75 (60 residues), 31.9 bits, 1.1e-10
  • amino acids 84 to 143 (60 residues), 25.5 bits, 1.1e-08
  • amino acids 153 to 214 (62 residues), 30.7 bits, 2.6e-10
  • amino acids 266 to 308 (43 residues), 27.6 bits, see alignment (E = 2.4e-09)
  • amino acids 667 to 731 (65 residues), 27.3 bits, 3e-09
  • amino acids 810 to 863 (54 residues), 26.1 bits, 6.9e-09
• PF13176: TPR_7
  • amino acids 75 to 105 (31 residues), 14.7 bits, see alignment (E = 2.2e-05)
  • amino acids 110 to 138 (29 residues), 14.9 bits, see alignment (E = 1.8e-05)
  • amino acids 244 to 272 (29 residues), 17.5 bits, see alignment (E = 2.8e-06)
  • amino acids 280 to 308 (29 residues), 22.6 bits, see alignment (E = 6.2e-08)
  • amino acids 798 to 830 (33 residues), 19.1 bits, see alignment (E = 8.8e-07)
• PF13374: TPR_10
  • amino acids 106 to 135 (30 residues), 15.5 bits, see alignment (E = 1.2e-05)
  • amino acids 243 to 272 (30 residues), 20 bits, see alignment (E = 4.3e-07)
  • amino acids 278 to 304 (27 residues), 22.7 bits, see alignment (E = 6.4e-08)
• PF07721: TPR_4
  • amino acids 109 to 129 (21 residues), 13.1 bits, see alignment (E = 0.00011)
  • amino acids 175 to 193 (19 residues), 11 bits, see alignment (E = 0.0005)
  • amino acids 277 to 301 (25 residues), 20.9 bits, see alignment (E = 3.1e-07)
  • amino acids 657 to 679 (23 residues), 12.5 bits, see alignment (E = 0.00016)
  • amino acids 696 to 717 (22 residues), 10 bits, see alignment (E = 0.001)
• PF13181: TPR_8
  • amino acids 109 to 139 (31 residues), 18.9 bits, see alignment (E = 1e-06)
  • amino acids 208 to 241 (34 residues), 15.1 bits, see alignment (E = 1.7e-05)
  • amino acids 244 to 274 (31 residues), 16.1 bits, see alignment (E = 7.9e-06)
  • amino acids 277 to 308 (32 residues), 24.9 bits, see alignment (E = 1.2e-08)
• PF07719: TPR_2
  • amino acids 110 to 139 (30 residues), 22.9 bits, see alignment (E = 5.1e-08)
  • amino acids 140 to 172 (33 residues), 24.4 bits, see alignment (E = 1.7e-08)
  • amino acids 277 to 308 (32 residues), 33.2 bits, see alignment (E = 2.5e-11)
• PF13414: TPR_11
  • amino acids 113 to 148 (36 residues), 27.9 bits, see alignment (E = 1.2e-09)
  • amino acids 283 to 316 (34 residues), 27.1 bits, see alignment (E = 2.1e-09)
• PF13424: TPR_12
  • amino acids 207 to 273 (67 residues), 35.7 bits, 6.5e-12
  • amino acids 657 to 725 (69 residues), 31.4 bits, 1.4e-10
• PF13431: TPR_17
  • amino acids 230 to 262 (33 residues), 27.1 bits, see alignment (E = 2.5e-09)
  • amino acids 266 to 295 (30 residues), 24 bits, see alignment (E = 2.5e-08)
• PF13174: TPR_6
  • amino acids 277 to 308 (32 residues), 18.1 bits, see alignment (E = 2.6e-06)
• PF00515: TPR_1
  • amino acids 277 to 308 (32 residues), 35.6 bits, see alignment (E = 4.4e-12)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Protein Sequence (1183 amino acids)

>MPMX19_04212 Photosystem I assembly protein Ycf3 (Azospirillum sp. SherDot2)
MAKHTNMLAQAVAHHQAGRAAEAERGYRDVLTKDPRNADAMHLLGVLALQSGHAEEAVTL
IGKALAQTRGVADYWDNLGSALSAAGRPDEAVQAHHNATILDPQGAQRRHNLGNALAALG
RHDEAQRAFAAALALKPDYAKAWYNLGNGHAALHRYGGAVTALDRAVQLAPGMVEAHNNL
GDALAMAGRLDEAIAQHRLVTRHRPDDATAFYNLGAVLQQKSAFESAEIAYRQALKRNPR
HSAALNNLGSVLKRLGRPDQAELCHRQALDLYPEFVEARYNLGNALQAQGRYEEAAACFE
EALAQQPDLATATYNLSLLALLHGDIARGWAGYERRFAAGEAVPNRRFPIPRWGGEVLRG
KRLLIWREQGVGDEMMFASCYPDVVAWAGGPVTIECDPRLVPLFRRSFPKATVRAESCTG
DAFGEPLRETIDPPDCDLQVAAGDLPELLRGSLSAFEPQGPWLVADPALVERWRERLAGL
GPGLRVGIGWRSQLMTVDRKAAYVMLEHWGPLFAVPGLTFVNLQYGECEAELRAAEERFG
VTIHRWADLNLKDDFDGAAALTANLDLVISPAMSAGELAGALGLPVWRFGSRDWTQLGTE
ARPWFPTMRLFQPRPGEALDSIVGATAQALRAIMPDPKPASDEKAVPEPETPADFDALLN
HAADLHRNGRPDEAEAAYRAAIAADPRREALGHPDALHLLGLLMHQTGRNDDALALIGEA
LRIDPAFPQAWNHLGLVHEMEKRHADSSFAFARALALHPAYPEALTHLGLVHQIGGRPAE
GMRLHRRAIAIQPDHIPAHANLGHACELTGQTSEATGHYRRALALQPESAEANNNLATMA
TLANRLDEAKSHLRRALRVDPGFALAAWNLGLMDLADGRIAEGWAGYSRRFSARQLQRAR
RIDRPVWTGEALRGRRLLVWSEQGVGDEILFASCFDALNGLDGPVTVECDRRLVSLFARS
FPGVAVRAETADPAGRETIDPPDCELQMPAGNLPALVRDRVARYPDRPAYLRPDPGLVVQ
WRDRLAALPGLKVGLAWRSQIVTAQRAAAYTGLADWVALLDMPGVSVVMLQYGDCTAELA
RVETATRRLHRWDDLNLKDDFEGVSALIANLDLVISPATAVGELAGALGTPVWRLGTRDW
TQIGTGVRPWFPPMRLIQPQEGQGLADAARRAVHALAALAPTG